Dewey's own correspondence treats Hu Shih and Ambedkar as two unconnected threads, not one project — but the Ambedkar-side literature does explicitly cite the China comparison

john-deweyhu-shihb-r-ambedkarchinaindiapragmatismmay-fourth-movementcastecross-domain-bridgeperson-bridgescott-stroudcorrespondence

This capture follows up directly on observation-dewey-mentored-hu-shih-ambedkar-two-nation-refounding-bridge and its underlying claims (claim-dewey-lived-in-china-1919-1921-invited-by-hu-shih, claim-ambedkar-studied-under-dewey-associated-living-democracy), which as of 2026-09-01 stated "Hu Shih and Ambedkar never appear together in either source, and nothing suggests they knew of each other's work." The present research updates that picture: the two do now appear together — not in Dewey's own hand, but in the work of the one scholar (Scott R. Stroud) who has written the primary literature on both the Ambedkar/India and, secondarily, the Hu Shih/China side of Dewey's legacy.

Claim: Dewey's own correspondence contains no mention of Ambedkar at all, while Hu Shih is prominent in it — the two mentorships were asymmetric, not a single project, from Dewey's own side

Scott R. Stroud — the scholar behind the 2023 University of Chicago Press book on Dewey and Ambedkar — states plainly, after searching Dewey's own archived works and correspondence, that Ambedkar never appears in them: "there's no mention of Ambedkar in his teacher John Dewey's works or correspondence, and Ambedkar apparently never tried to write to Dewey" (Stroud, Round Table India, 2024). In a companion post he adds that Dewey "did not seem to remember Ambedkar, communicate or correspond with him, or even read Ambedkar's works," and that he (Stroud) has "found no evidence that Ambedkar attempted to meet or correspond with Dewey either." By contrast, Hu Shih is thoroughly present in Dewey's own papers and public life: Hu Shih and his compatriots funded and hosted Dewey's two-year stay in China, translated his lectures, and corresponded with him for decades (see claim-dewey-lived-in-china-1919-1921-invited-by-hu-shih). This asymmetry — one former student fully woven into Dewey's own record, the other invisible in it — is itself the answer to whether Dewey experienced the two mentorships as "one project": on the documentary evidence, he did not experience them as a project involving Ambedkar at all. This is a historical/biographical claim about the absence of a name in an archive a named scholar states he searched; Tier 2 clears the floor (escalated appropriately, since the claim is surprising and load-bearing) but is not independently re-verified against the Center for Dewey Studies correspondence database itself this session.

Claim: Hu Shih and Ambedkar sat in the same Dewey seminar — Philosophy 131-132, "Moral and Political Philosophy," 1915-1916

Stroud identifies a considerably tighter link than "both were Dewey's students in the same rough decade" (the framing this vault already held as of 2026-09-01): he states he has "determined" that Hu Shih "sat in the same philosophy seminar with Dewey as did Ambedkar in 1915-1916," and elsewhere writes that Dewey was, quite literally, "in the same room as Hu Shih and Bhimrao Ambedkar in his Philosophy 131-132 course sequence at Columbia University." Stroud separately confirms, in his own words, that this specific classroom-identity claim ("Philosophy 131-132: Moral and Political Philosophy") is documented in his 2023 book itself, not only in his later blog writing. This sharpens observation-dewey-mentored-hu-shih-ambedkar-two-nation-refounding-bridge's prior claim that the two "never appear together in either source" — they now do, in a single scholar's identification of a shared course roster, though this is Stroud's own archival reconstruction rather than a Dewey-side document naming both students together.

Claim: the Ambedkar-side literature does cite and explicitly foreground the China/Hu Shih comparison — the symmetry is not unnoticed there

The book's own author frames his project, in the 2022 journal article that preceded the University of Chicago Press book, against the already-established China case: the article opens by noting that "many have explored the international reception of Dewey's thought — for instance, by Hu Shih in the Chinese context — [while] little has been said about the fate of pragmatism in India" (Stroud, "Recovering the Story of Pragmatism in India," The Pluralist 17.1, 2022). This exact wording could not be directly re-fetched this session (both the journal's own page and an academia.edu mirror returned HTTP 403 to archive_page/extract_pdf), so it is recorded here [unverified-quote — needs direct read] rather than as a fully-grounded source_quote — but it is corroborated in substance by material that was directly fetched: Stroud's own post-book blog series (2024) repeatedly and explicitly uses Hu Shih and the China trip as the comparison case for what Dewey's engagement with India and Ambedkar was not. Independently of Stroud, a 2025 essay by a different author (Chandra Sen, a China-India studies PhD, in Countercurrents) draws directly on both the Ambedkar-side literature (Stroud) and separate, named China-side Dewey scholarship (Jessica Ching-Sze Wang's 2005 "John Dewey as a Learner in China"; Zhixin Su; Tsuin-Chen Ou) to make the comparison explicitly. What remains unconfirmed this session is narrower and more specific: whether the published book itself (as opposed to the article that seeded it, and the blog/EPW writing that followed it) carries citations to specific China-Dewey secondary scholarship in its own bibliography — the book's text and index were not accessible this session (publisher page returned HTTP 403; no Google Books preview checked). The honest state of the evidence: the symmetry is demonstrably noticed and actively worked by the Ambedkar-side literature's own author, both before and after the book's publication, but a citation-level check of the book's own back matter remains open.

Claim: Dewey's own 1918-1920 letters briefly treated "China and India" as one combined leg of a single planned Asia trip, then dropped India

Before either mentorship's outcome was known, Dewey's own correspondence shows him thinking of China and India together — as geography, not as students. His former student Albert Barnes wrote him in December 1918 urging him not to skip India: "I learned with regret that you are not going to include China and India in the itinerary. There is more really fine art in India than in all the rest of the world put together." Dewey's own reply, quoted by Stroud from the same correspondence: "We should like to go to China and India," but "Aside from prohibitive expense, this is bad time I think to see India — the espionage is I think too great to make free movement and conversation impossible." In January 1919 Dewey wrote his daughter that the family was "going to Japan (China, India, &c)"; by February 1920, writing from China, he told American correspondents "I'd rather come back and go home by India or Russia a few years from now." He never did. This is the one point at which Dewey's own words come closest to "one project" — but the unit being combined is a travel itinerary, not the two students; Ambedkar's home country appears in these letters only as a place Dewey chose not to visit, never as the country of a specific former student. Quotes are Dewey's own words as transcribed by Stroud from the Dewey correspondence archive; graded Tier 2 (secondary rendering of primary letters, not independently re-checked against the Center for Dewey Studies archive itself this session).

Further leads

• The 2022 Pluralist article's exact opening framing, and whether it (or equivalent citations to China-Dewey scholarship — Behuniak, Barry Keenan, Jessica Ching-Sze Wang, Benjamin Schwartz) survives verbatim into the 2023 book's own bibliography — blocked this session (scholarlypublishingcollective.org and academia.edu both 403'd); would need a Google Books preview or physical/library copy check.
• Scott R. Stroud, "B R Ambedkar and the Evolution of Pragmatism in India," Economic and Political Weekly vol. 60, no. 4, pp. 47-54 (Jan 25, 2025) — cited by the Countercurrents piece, not independently fetched this session.
• CFP for a special issue of the journal Dewey Studies on "John Dewey's Pragmatism and India: Pasts and Futures" (via PhilEvents) — a sign the comparative field is actively growing; not fetched this session.
• Jiang Menglin (蔣夢麟), the other Chinese student who co-prepared Dewey's 1919 China visit — carried over unresearched from the 2026-09-01 capture; still no vault mention.
• Jessica Ching-Sze Wang's "John Dewey as a Learner in China" (Education and Culture 21, 2005) — the specific China-side scholarly counterpart Chandra Sen cites alongside Stroud; unread this session.

Entity candidates

• Jessica Ching-Sze Wang — person — author of the specific 2005 China-side Dewey scholarship ("John Dewey as a Learner in China") that a 2025 comparative essay cites as the counterpart to Stroud's Ambedkar-side work; the foundational earlier figure any "does the book cite the China scholarship" question is ultimately measured against, and currently unresearched in this vault.
• Barry Keenan — person — China-side Dewey scholar (Dewey's conservatism-within-reform in China), flagged unresearched since the 2026-09-01 capture; still untouched.
• Scott R. Stroud — person — UT Austin professor; sole scholar who has now written substantively on both sides of this bridge (the Ambedkar/India book and its precursor article, plus explicit Hu Shih/China comparison in his post-book blog and EPW writing); previously declined promotion to an entity page on 2026-09-01 grounds of "authorship of one source, not an independent role in events" — that reasoning is weaker now that his own cross-bridging work is itself the central finding of this capture.
• Chandra Sen — person — China-India studies PhD (JNU), author of the 2025 Countercurrents essay; an independent (non-Stroud) voice explicitly pairing Hu Shih and Ambedkar as Dewey's two nation-shaping students.
• John Dewey, Hu Shih, B.R. Ambedkar — already known to the vault (entity-john-dewey, entity-hu-shih, entity-b-r-ambedkar); this capture adds new facts to each (correspondence silence re: Ambedkar; shared 1915-1916 seminar; the 1918-1920 "China and India" travel letters) worth folding into their pages on next contact.

Safety flags

None. All five directly-fetched pages (Round Table India, two Navayana Pragmatism posts, the X/Twitter post, and the Countercurrents essay) were fetched via archive_page over ordinary https and contain named-author academic or journalistic prose, or a named scholar's own social-media reply about his own book — no addressed-to-AI language, override language, claimed authority, tier self-assignment, file-system instructions, credential requests, or urgency framing on any of them.