Does GAO-22-105357's own consortium-level lists (Table 4, Appendix II) name AC Gravity, AATIP, or AAWSAP anywhere?

other-transactions-authoritygaoantigravityaatipaawsapdefense-fundingverification

question-check-gao-22-105357-table4-appendix2-for-ac-gravity-aatip-mentions asked whether Table 4 (p. 43, "Selected Department of Defense Consortia and Associated Technology Areas") and Appendix II (p. 58, "List of Consortia that Received Department of Defense Other Transaction Agreement Awards, Fiscal Years 2019–2021") — the two sections of GAO-22-105357 that name individual consortia rather than just technology-area totals — contain AC Gravity, AATIP, or AAWSAP anywhere. The same Wayback Machine snapshot used by the 2026-10-19 sibling capture (identical sha256, tls:verified) was re-fetched and read in full this session specifically to answer this. The answer is no, on every count checked.

Claim: Table 4 lists 14 named DOD consortia by technology area (cybersecurity, munitions, hypersonics), and none of them is AC Gravity, AATIP, or AAWSAP

verifies: question-check-gao-22-105357-table4-appendix2-for-ac-gravity-aatip-mentions

Table 4 (p. 43) cross-tabulates selected consortia against three overlapping technology flags — cybersecurity, munitions, and hypersonics — to illustrate GAO's finding that "multiple" consortia cover similar technology areas. The table's left-hand column enumerates: system of systems, command/control/communications, defense industrial base, spectrum, sensors and communications, information warfare, maritime sustainment, naval surface, aviation and missiles, armaments, naval aviation, undersea technology, university hypersonics, and spectrum and trusted systems. Every name is a conventional defense-acquisition technology area; none references AC Gravity, AATIP, AAWSAP, antigravity, or any comparable exotic-propulsion or fringe-physics domain.

Claim: Appendix II's Table 7 — the full 28-consortia roster behind Figure 5's totals — names every consortium DOD awarded OT agreements to from FY2019–2021, and AC Gravity, AATIP, and AAWSAP are absent from all 28

verifies: question-check-gao-22-105357-table4-appendix2-for-ac-gravity-aatip-mentions

Appendix II's Table 7 (pp. 58–60) is GAO's complete, named roster of "the list of 28 consortia that received other transaction agreement awards from the Department of Defense from fiscal years 2019 through 2021," giving each consortium's full name, short name, managing CMO, year created, member count, and sponsoring military department or DOD office. The 28 full consortium names run from "Advanced Manufacturing, Materials, and Processes" through "Vertical Lift Consortium," managed collectively by only twelve CMOs (ATI, CMG, SOSSEC, NSTXL, Battelle, the Army itself, and a handful of others). Reading the full table — the most granular consortium-level accounting GAO produced in this report — turns up no AC Gravity, AATIP, or AAWSAP entry among the 28.

Claim: A complete read of all 75 pages of GAO-22-105357 (not just Table 4 and Appendix II) finds zero occurrences of "AC Gravity," "AATIP," "AAWSAP," or "antigravity" anywhere in the document

verifies: question-check-gao-22-105357-table4-appendix2-for-ac-gravity-aatip-mentions

Beyond the two consortium-level tables specifically named in the routing question, the entire extracted text of the report — Highlights, Letter (Background, both findings sections, Conclusions, Recommendations, Agency Comments), Appendix I (Objectives, Scope, and Methodology, including Tables 5 and 6's lists of individually-selected sample OTAs and project awardees), Appendix III (DOD's written comments), Appendix IV (staff acknowledgments), and the Abbreviations list — was read end-to-end this session and searched for the same four strings. None occurs anywhere. This closes the gap claim-ac-gravity-aawsap-not-same-funding-mechanism-nor-found-in-watchdog-material's [unverified] flag named as the one remaining untested document, joining the already-negative result from claim-dodig-2021-077-dodig-2022-127-no-mention-of-ac-gravity-aatip-aawsap. Taken together, the most detailed primary accounting GAO, CRS, and DoD IG each independently produced of DOD's OT consortia landscape contains no trace of AC Gravity, AATIP, or AAWSAP by name.

Further leads

• DOD officials told GAO they were aware of a consortia list maintained by the MITRE Corporation but that GAO found it "was not comprehensive, as it did not include some consortia" (p. 44–45) — an independent, non-governmental consortia roster that has not been checked for AC Gravity/AATIP/AAWSAP mentions and could plausibly cover ground GAO's own 28-consortium list does not.
• GAO-21-501 (the July 2021 COVID-19 OTA report GAO-22-105357 repeatedly cites as the source of its $7.2B figure and prior recommendations) remains unfetched independently in this vault; it predates and is measured against by GAO-22-105357's own figures, and is the earlier primary record the present report's medical-defense accounting extends rather than restates.
• Table 5 and Table 6 (Appendix I, pp. 54–55) individually name 12 sampled base OTAs and their project awardees (e.g., Southwest Research Institute, Raytheon, Desktop Metal, Dynetics, Qorvo Texas) — a disjoint, much smaller named-contractor list from Appendix II's consortium roster, not separately checked for AC Gravity by name since AC Gravity was never a consortium member in any list found.

Entity candidates

• GAO-21-501 ("COVID-19 Contracting: Actions Needed to Enhance Transparency and Oversight of Selected Awards," July 26, 2021) — document — the earlier GAO primary that this report's $8.0B medical-defense figure and FPDS-tracking recommendations are explicitly measured against and extend; repeatedly cited as prior art rather than independently read in this vault.
• MITRE Corporation — organization — a not-for-profit FFRDC operator that DOD officials cited as maintaining its own (GAO-assessed-as-incomplete) list of DOD consortia; a second, non-GAO consortia census not yet checked against the AC Gravity/AATIP/AAWSAP question.
• Table 7 / Appendix II's 28 named consortia (e.g., National Armaments Consortium, Space Enterprise Consortium, Cornerstone Consortium) — concept/list — the single most granular consortium-level roster located in any primary document this vault has reached; already the direct subject of this capture's Claim 2, not proposed as individual entity pages.