A shared teacher is not a shared project — John Dewey taught Hu Shih and B.R. Ambedkar, who each refounded a nation, but the only joint is a 1915–16 classroom roster, reconstructed by a later scholar and documented asymmetrically in Dewey's own record

john-deweyhu-shihb-r-ambedkarpragmatismchinaindiamay-fourth-movementcastecross-domain-bridgeperson-bridgehistoriographyargument-from-silence

The recurring argument in this cluster is not "John Dewey's influence in Asia" and not "two famous students of one famous professor." It is a discipline about how much a shared origin is allowed to claim: John Dewey taught two Columbia students — Hu Shih and B.R. Ambedkar — who each became foundational to a different nation's 20th-century refounding (China's May Fourth modernization; India's constitution and anti-caste movement). That bridge is real. But it is a shared teacher, not a shared project: the two men's work never connected, Dewey's own record registers Hu Shih richly and Ambedkar not at all, and the single point at which the two are placed in one room is a 1915–16 course roster reconstructed by a present-day scholar, not a document from Dewey's own hand. The interesting object here is the exact size of the joint — a classroom, and only a classroom.

Titled for the argument — a shared teacher is not a shared project — not for Dewey, the most-mentioned figure, nor for "pragmatism in Asia," the topic (the 2026-07-25 lesson). What makes this a map rather than a list is the asymmetry of the evidence: a well-documented, Dewey-side China leg; an India leg that rests on one scholar's archival reconstruction and a Tier-1 phrase in Dewey's own 1888 prose; and a documented silence on the India side of Dewey's own papers that is itself the finding. It is a naming cousin of moc-a-shared-shape-is-not-a-shared-stake (a superficial parallel invoked as if it were a deep one) and moc-a-phrase-is-not-a-pedigree (a shared word mistaken for a shared lineage), kept as its own page because the thing not to overread here is a person's teaching career, not an analogy or a phrase. The method-level prongs below also touch moc-argument-from-silence and moc-reconstructed-in-public-unconfirmed-in-fact; neither currently lists these notes.

The two ends of the bridge

The positive claim, split by nation. These are the two legs a reader would want to check first — and they are the cluster's best-sourced notes.

• claim-dewey-lived-in-china-1919-1921-invited-by-hu-shih — the China leg. Dewey arrived in 1919 for a planned short visit and stayed more than two years, through the height of the May Fourth Movement, at the invitation of his former students (Behuniak names Hu Shih and Jiang Menglin; the title's "invited by Hu Shih" is a compression the member note documents, Hu Shih being the named principal). Dewey called it "intellectually the most profitable thing I've ever done." Tier 2 (Behuniak, a named Fulbright scholar), cross-model audited 2026-09-03 (claude-fable-5), which caught and fixed a real error — the body had singularized the invitation to Hu Shih alone. verified_verbatim. The strongest leg of the map.
• claim-ambedkar-studied-under-dewey-associated-living-democracy — the India leg. Ambedkar studied under Dewey at Columbia 1913–1916 and built his definition of democracy ("not merely a form of Government ... primarily a mode of associated living") on Dewey's teaching as an argument against caste, writing "I owe all my intellectual life to him." The "I owe all my intellectual life" line is Tier 2 (Stroud/Aeon, the sole essay-length source), but the load-bearing conceptual claim is anchored on a direct Tier-1 read of Dewey's own 1888 The Ethics of Democracy — "democracy means that personality is the first and final reality" — not on Stroud's paraphrase. verified_verbatim; not yet second-model re-checked (see audit_status). The weaker-sourced of the two legs, and the first thing a cross-model pass should re-read.

Supporting the China leg's richness — the Dewey–Hu Shih bond that predates and outlasts the trip:

• claim-china-institute-of-america-founded-1926-by-dewey-hu-shih-monroe-and-kuo — seven years after the China stay, Hu Shih co-founded the China Institute of America alongside Dewey (with Monroe and Kuo Ping-Wen). Evidence that the teacher–student relationship on the China side was a decades-long working bond, not a single visit. Capture-verified institutional self-statement; no verified_verbatim — the softest-sourced spine note, carried as corroborating texture, not as a load-bearing beat. (This note also links outward to a separate Goodrich/Liberty-Fund cluster; that is not part of this argument.)

The one joint (a roster, not a meeting)

The single point at which the two students are placed together — and the honest limit on what it establishes.

• claim-hu-shih-and-ambedkar-shared-dewey-seminar-1915-1916 — Stroud states he has "determined" that Hu Shih and Ambedkar sat in the same Dewey seminar, Philosophy 131-132 "Moral and Political Philosophy," 1915–16, and that this is documented in his 2023 University of Chicago Press book. Two Tier-2 posts from the scholar's own venue plus a Tier-3 social-media confirmation; verified_verbatim. This superseded the organizing note's original "the two never appear together" line (corrected 2026-09-10). But it is a roster reconstruction by a present-day scholar, not a Dewey-side document naming both students — "two men once sat within arm's reach of the same teacher," as the member note's own commentary puts it, not "two men who knew each other." The joint is real and it is small; the map keeps it that size.

Why it is structural, not causal

The two notes that keep the bridge from being overread — the documented silence on Dewey's own side, and the counterfactual he declined.

• claim-dewey-correspondence-and-works-contain-no-mention-of-ambedkar — the asymmetry, and the map's methodological edge. Stroud, the author of the sole book-length study, states after searching Dewey's own works and correspondence that Ambedkar never appears in them, and that "Ambedkar apparently never tried to write to Dewey." Set against Hu Shih — pervasive in Dewey's papers, funding and hosting the China stay, corresponding for decades — this is the direct answer to whether Dewey experienced his two students' later careers as one connected project: on the documentary evidence, from his own side, he did not. Tier 2, cross-model audited 2026-09-11 (which corrected a quote misattribution between two Stroud posts); verified_verbatim. An absence-claim, resting on the best-positioned person alive to make it — the member note is explicit that it records Stroud's search rather than independently confirming the silence, "an honest limit, not a hedge." This prong is where the cluster touches moc-argument-from-silence.
• claim-dewey-1918-1920-letters-combined-china-india-then-dropped-india — the counterfactual that did not happen. Dewey's own 1918–1920 letters show him briefly treating "China and India" as one combined Asia itinerary, then dropping India ("the espionage is I think too great"). The one place Dewey's own words come nearest to joining China and India — but the unit being joined is a travel itinerary, not the two students; India appears only as a place he chose not to visit, never as the country of a specific former student. Tier 2 (Stroud rendering Dewey's own correspondence), cross-model audited 2026-09-11 (corrected the source pointer). The sentence one step from the counterfactual where Dewey goes to India and meets a young law student named Ambedkar — which never happens.

Open threads (honest caveats, not hidden)

• Argument B — does the scholarship actually anchor the comparison? — is parked here on purpose, not resolved. The same cluster carries a second, distinct thread: an epistemic/verification argument about whether the India-side literature (Stroud) demonstrably foregrounds the Hu-Shih/China comparison at the citation level. Its members are real but its anchor is not yet confirmed: claim-stroud-ambedkar-scholarship-explicitly-cites-hu-shih-china-comparison (whose strongest leg, the 2022 Pluralist opening, is flagged [unverified-quote] behind a 403 wall), claim-stroud-2023-uchicago-blog-post-independently-foregrounds-hu-shih-china-comparison (a third independent sighting, Tier 1, verified), claim-stroud-2023-book-back-matter-is-notes-then-index-no-standalone-bibliography (structural), and claim-google-books-search-index-hits-hu-shih-and-ching-sze-wang-not-keenan-behuniak-schwartz-in-stroud-book (Tier 3, [unverified-quote]). The routing question question-stroud-2022-article-and-2023-book-china-scholarship-citations is OPEN: the verbatim-survival of the 2022 opening into the 2023 book, and the book's own China-side citations, remain untested — every full-text route 403'd. Argument A does not depend on Argument B: the structural bridge stands on the cross-model-audited China leg, the Tier-1-anchored India leg, the silence, and the itinerary. Argument B would strengthen the India side's citation footing, not establish the bridge. When the open question settles (or the Pluralist opening is read directly), this thread is a clean fold-in — a "how solid is the India side?" verification section — or its own small map near moc-reconstructed-in-public-unconfirmed-in-fact. Not tonight.
• Every member note is status: seedling, and the map says so. This records the cluster's current footing; it does not freeze it. The India leg in particular is single-scholar-sourced above its Tier-1 phrase and has had no second-model reading.
• A bridge this vault's own tools are structurally blind to. The organizing note observation-dewey-mentored-hu-shih-ambedkar-two-nation-refounding-bridge records that neither leg scored as a bridge_candidate — the connecting fact is a teaching career, not a shared text, sentence, or citation, which cosine retrieval has no feature for. Worth remembering as a standing caution: the thinness a hop chain feels may be the tool's blind spot, not the absence of a story.
• The cluster already has a draft. Several members carry drafted_in: [the-same-classroom]; an essay thread exists in 70-drafts/ (outside the Warden write surface, untouched this pass). The MOC is the navigation layer that draft has been missing, not a substitute for it.